PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007832P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 337aa    MW: 37664.3 Da    PI: 8.6989
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007832P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.31.6e-32129184359
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                      +rY+eClkNhAas+Ggh++DGCgEfmp+ ge+gt++a+kCaAC+CHRnFHR+e+++
  MELO3C007832P1 129 VIRYRECLKNHAASTGGHVLDGCGEFMPN-GEDGTTEAMKCAACECHRNFHRKEMKD 184
                     689*************************8.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-21130182IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.2E-30130182IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.1E-29131182IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.243132181IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.5E-28265334IPR009057Homeodomain-like
SuperFamilySSF466891.2E-18271333IPR009057Homeodomain-like
TIGRFAMsTIGR015651.9E-27272329IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
METRSEDEEI GTPNSPLCYN NPSSNRESLI KLPNLDHPFL TAADRRRDHT VPQLHFSTHQ  60
KSTLHHIHKQ HTRDHPEATP DPPIQSSIPA SPSSAATPTP LAIASTSSRL ISRTPSFAGA  120
TDNTIRSSVI RYRECLKNHA ASTGGHVLDG CGEFMPNGED GTTEAMKCAA CECHRNFHRK  180
EMKDDPPLQQ ALPTGFFVSN SIRNNGHRTD RTPVVPVSRH HQLPAVPISS MMMAFGGSNG  240
APDESSSEDL NMYHPSNNGA RDLFGQQTQL IKKRFRTKFT QGQKDKMEEF AEKLGWKIQK  300
HDELEVQQFC AEVGVRRQVF KVWMHNNKQG MKKKQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-252733281873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440720.10.0PREDICTED: zinc-finger homeodomain protein 2
RefseqXP_008440719.10.0PREDICTED: zinc-finger homeodomain protein 2
RefseqXP_008440718.10.0PREDICTED: zinc-finger homeodomain protein 2
RefseqXP_008440717.10.0PREDICTED: zinc-finger homeodomain protein 2
RefseqXP_008440716.10.0PREDICTED: zinc-finger homeodomain protein 2
SwissprotQ9ZPW72e-64ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A0A0KH030.0A0A0A0KH03_CUCSA; Uncharacterized protein
STRINGPOPTR_0007s12970.18e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.15e-65homeobox protein 24